1.83 Rating by ClearWebStats
chaletsofthesmokies.com is 2 decades 4 years 6 months old. It has a .com as an domain extension. This website has a Google PageRank of 1 out of 10. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, chaletsofthesmokies.com is SAFE to browse.
Get Custom Widget

Traffic Report of Chaletsofthesmokies

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: 2

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for chaletsofthesmokies.com Good
WOT Privacy: WOT privacy rank for chaletsofthesmokies.com Good
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View chaletsofthesmokies.com Pagerank
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 1 out of 10
PageSpeed Score
76
Siteadvisor Rating
View chaletsofthesmokies.com site advisor rating Not Applicable

Where is chaletsofthesmokies.com server located?

Hosted IP Address:

92.48.78.51 View other site hosted with chaletsofthesmokies.com

Hosted Country:

chaletsofthesmokies.com hosted country GB chaletsofthesmokies.com hosted country

Location Latitude:

51.5228

Location Longitude:

-0.71986

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View chaletsofthesmokies.com HTML resources

Homepage Links Analysis

Chalet of the Smokies | Vacation blog

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 11
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 92.48.78.51)

Nothing found for 406 Shtml

chaletsofthesmokies.com favicon - i-doo.org

View chaletsofthesmokies.com Pagerank   chaletsofthesmokies.com alexa rank 3,656,703   chaletsofthesmokies.com website value $ 240.00

The Prestige

chaletsofthesmokies.com favicon - dianafigueroapa.com

View chaletsofthesmokies.com Pagerank   chaletsofthesmokies.com alexa rank 922,219   chaletsofthesmokies.com website value $ 720.00

A Glass of Blessings -

chaletsofthesmokies.com favicon - helmetcamfirefighter.com

View chaletsofthesmokies.com Pagerank   chaletsofthesmokies.com alexa rank 418,357   chaletsofthesmokies.com website value $ 5,760.00

蛻台コ倶コ倶サカ縺ョ隗」豎コ繧貞シ∬ュキ螢ォ縺ォ萓晞

chaletsofthesmokies.com favicon - newarkdelawarecriminaldefenselawyer.com

View chaletsofthesmokies.com Pagerank   chaletsofthesmokies.com alexa rank Not Applicable   chaletsofthesmokies.com website value $ 8.95

Azenx – Hi-Gear Inspiration

chaletsofthesmokies.com favicon - azenx.com

View chaletsofthesmokies.com Pagerank   chaletsofthesmokies.com alexa rank Not Applicable   chaletsofthesmokies.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 406
Status: 406 Not Acceptable
Date: Fri, 30 May 2014 09:45:28 GMT
Server: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.3.28
X-Pingback: http://www.chaletsofthesmokies.com/xmlrpc.php
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for chaletsofthesmokies.com

Domain Registrar: GODADDY.COM, LLC chaletsofthesmokies.com registrar info
Registration Date: 1999-10-14 2 decades 4 years 6 months ago
Last Modified: 2013-11-13 1 decade 5 months 4 weeks ago
Expiration Date: 2014-10-01 9 years 7 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns1.seafooddomains.com chaletsofthesmokies.com name server information 213.229.101.106 chaletsofthesmokies.com server is located in United Kingdom United Kingdom
ns2.seafooddomains.com chaletsofthesmokies.com name server information 213.229.101.106 chaletsofthesmokies.com server is located in United Kingdom United Kingdom

DNS Record Analysis

Host Type TTL Extra
chaletsofthesmokies.com A 14392 IP:92.48.78.51
chaletsofthesmokies.com NS 86400 Target:ns2.ndx21.com
chaletsofthesmokies.com NS 86400 Target:ns1.ndx21.com
chaletsofthesmokies.com SOA 86400 MNAME:ns1.ndx21.com
RNAME:rt.skynethosting.net
Serial:2013111303
Refresh:86400
Retry:7200
Expire:3600000
chaletsofthesmokies.com MX 14400 Target:chaletsofthesmokies.com

Similarly Ranked Websites to Chaletsofthesmokies

Google

chaletsofthesmokies.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View chaletsofthesmokies.com Pagerank   Alexa rank for chaletsofthesmokies.com 1   website value of chaletsofthesmokies.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

chaletsofthesmokies.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View chaletsofthesmokies.com Pagerank   Alexa rank for chaletsofthesmokies.com 1   website value of chaletsofthesmokies.com $ 8,833,062,960.00

Gmail

chaletsofthesmokies.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View chaletsofthesmokies.com Pagerank   Alexa rank for chaletsofthesmokies.com 1   website value of chaletsofthesmokies.com $ 8,833,062,960.00

Android Apps on Google Play

chaletsofthesmokies.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View chaletsofthesmokies.com Pagerank   Alexa rank for chaletsofthesmokies.com 1   website value of chaletsofthesmokies.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

chaletsofthesmokies.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View chaletsofthesmokies.com Pagerank   Alexa rank for chaletsofthesmokies.com 1   website value of chaletsofthesmokies.com $ 8,833,062,960.00